SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KSZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KSZ3
Domain Number 1 Region: 326-590
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.06e-65
Family Nuclear receptor ligand-binding domain 0.00000000961
Further Details:      
 
Domain Number 2 Region: 253-331
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.6e-28
Family Nuclear receptor 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KSZ3
Sequence length 592
Comment (tr|I3KSZ3|I3KSZ3_ORENI) Nuclear receptor subfamily 4 group A member 1 {ECO:0000313|Ensembl:ENSONIP00000024239} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=NR4A1 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MPCVQTQYASLPHDNYFSSEFLNPDLSATLVMDFSGQKDQLSTSSLPSINTLVGNGYVGE
FDAYSCKITTSPPASTVSFSHTGVAESTSSQMHSQAFKLDDLQVYGCYPGSFALNCLDET
LSSCSSDYYGSPVYATASPPTPSFQTESAPVWDSPFSPYPSAPLPSVADKAAIAQQLSFF
TFSSAPEQHSPMGQQHQDAQPSQEDHFFLSPQQHVSSLHCPPVSLEHRLLESPKTAEGAM
MSPKTPNPGSSESRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKDCPVD
KRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKIPVEASSTTPSVNIIASL
VRAHLDSSPTIGKLDYSKYRETADSSKEKEDAGDIQQFYDLLTGSLDVIRKWAQSIPGFM
DFCTEDQELLLESAFVELFILRLAYGSDPEKNELIFCNGVVLHRLQCARSFGDWIDSIVD
FSHSLRRLNLDVSLFSCLAALVIITDRHGLKEPKRVEDFQSHLITCLREHVSGNGSELSR
TQPNYQSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVEKIFMDTLPF
Download sequence
Identical sequences I3KSZ3
ENSONIP00000024239 XP_003441554.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]