SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KSZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KSZ4
Domain Number 1 Region: 342-606
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-65
Family Nuclear receptor ligand-binding domain 0.00000000961
Further Details:      
 
Domain Number 2 Region: 269-347
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.81e-28
Family Nuclear receptor 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KSZ4
Sequence length 608
Comment (tr|I3KSZ4|I3KSZ4_ORENI) Nuclear receptor subfamily 4 group A member 1 {ECO:0000313|Ensembl:ENSONIP00000024240} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=NR4A1 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
LMKLEACWGNETDISAMPCVQTQYASLPHDNYFSSEFLNPDLSATLVMDFSGQKDQLSTS
SLPSINTLVGNGYVGEFDAYSCKITTSPPASTVSFSHTGVAESTSSQMHSQAFKLDDLQV
YGCYPGSFALNCLDETLSSCSSDYYGSPVYATASPPTPSFQTESAPVWDSPFSPYPSAPL
PSVADKAAIAQQLSFFTFSSAPEQHSPMGQQHQDAQPSQEDHFFLSPQQHVSSLHCPPVS
LEHRLLESPKTAEGAMMSPKTPNPGSSESRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQ
KNAKYVCLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKIP
VEASSTTPSVNIIASLVRAHLDSSPTIGKLDYSKYRETADSSKEKEDAGDIQQFYDLLTG
SLDVIRKWAQSIPGFMDFCTEDQELLLESAFVELFILRLAYGSDPEKNELIFCNGVVLHR
LQCARSFGDWIDSIVDFSHSLRRLNLDVSLFSCLAALVIITDRHGLKEPKRVEDFQSHLI
TCLREHVSGNGSELSRTQPNYQSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVEK
IFMDTLPF
Download sequence
Identical sequences I3KSZ4
ENSONIP00000024240 ENSONIP00000024240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]