SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KUN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KUN5
Domain Number 1 Region: 24-159
Classification Level Classification E-value
Superfamily Cupredoxins 3.04e-47
Family Ephrin ectodomain 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3KUN5
Sequence length 224
Comment (tr|I3KUN5|I3KUN5_ORENI) Ephrin-A3a {ECO:0000313|Ensembl:ENSONIP00000024831} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100708995 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MALATFSLSLITLALTNLHLSRASNRHAVYWNSSNLLLRREGYTVQVSVNDYLDIYCPHY
NTSQRGTLERVVAEQYILYMVDYHGYRTCNTQKGSKRWECNRPHAPHAPIKFSEKFQRYS
AFSLGYEFNVGKEYYYISTPTHHHHGHSCLRLRVFVCCSTVSQADEDSIQTPDYTVRPNI
KIHNIDEFNPEVPKLEKSVSGSSPSRDRLLLTVAMLLVSAVLLS
Download sequence
Identical sequences I3KUN5
XP_004549121.1.88231 XP_005457288.1.78416 XP_005740715.1.53837 XP_005927662.1.24487 XP_006788055.1.46954 ENSONIP00000024831 ENSONIP00000024831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]