SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KUQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KUQ6
Domain Number 1 Region: 22-109
Classification Level Classification E-value
Superfamily UBA-like 7.86e-28
Family UBA domain 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3KUQ6
Sequence length 1200
Comment (tr|I3KUQ6|I3KUQ6_ORENI) Ubiquitin associated protein 2-like {ECO:0000313|Ensembl:ENSONIP00000024852} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=ubap2l OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MMTSMGGNRARGNWEQTQGQTQSQTQHKQRPQATAEQIRLAQMISDHNDDFEEKVKQLID
ITGKDQDESMIALHDCNGDVNRAINVLLEGSPDTDSWEMVGKKKGVSGQKETSQAETGDE
GKENREKGGEKDAARRRGGAPRKGRGASRGREFRGQENGLDGGKAGVAGRGAERGRRGRG
RGRGAVGASGRRGGRFSAQGMGTFNPADYAEPAQTEENYGGGSTWNNTGSVELEEGARLE
YSAGEGTNYPPKFDSAPVTGAWRSATEEWGTEDWNEDLSETKIFTASSVASMPLPQENVT
ITKGQRIDLAVLLGKTPPSSSSETENAPMEATQPPSLSQSLVFSNSKQGVPLSQTSSSTP
YTQHNMVSMLSKGFGEVGEPKGASTGTTGSQFLEQYKTAQALAQLAAQHSQTGPPNTTPS
SWDTSAASLGQYDMKAQPESAIHTPFTKRQPYQAATSTSSMLDVFLQDKGLPPSSSVSSS
SSLPQQTTSSPHVVPPPASSLPKMAGVPSLGQQVSPSSSDAQGSSPLPLQQHKIKQQKKR
ASINTKIPAMAVEMPGSTDISGLNLQFGALQFGSEPVLPEYESSSATTTPGNQVQNSLYT
SPSSESTPVLSNSSQMDLYDQRPSQTRRYPPSVSSSPQKDLQPKNGFSSIQAAQSVEAAA
GSAVSVKPASDSVTPASVSSMGTLTDSSSASLLTTANQTPLSALGHNEDLPPSSMAPPQH
NNSHPSQQNSLTPSVRTSNSGLLHPSVDGDSSLHSSSFPSSVSAVPSSSVPCSSSSVAAA
QVSLGAPQASSVGSATVSAPSGLGPVSSLAMGLNTASMGAPAAAAAAATASVSTAASTIP
SSASSSSTRSSAASSGKAPPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYGYDDLQMLQTR
IPLDYYSIPFAATPTTALTGREGSLTSNPYSGDLSKFGRADASSPAPATTLAQTQQNQSQ
THHTTQQPFLNPALPPGYSYTSLPYYTGMPGLPNTFQYGPAVFPVAPTSSKQHGVNVGVN
ASATPFQQASGYGSHGYSTGYEDVGQASGSGDFCKGGYGTAVAAAASAQNKPASSVTGPG
VGVSVTSSNTGVPDISGSVYTKTQSFEKQGFHAGTPAASFSLPSALGSGGPINPPAAAGY
APAPFMHILTPHQQPHSQILHHHLQQDGQSGTGQRSQNASIQQKSQINKSAYNSYSWGAN
Download sequence
Identical sequences I3KUQ6
ENSONIP00000024852 ENSONIP00000024852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]