SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KV34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KV34
Domain Number 1 Region: 59-251
Classification Level Classification E-value
Superfamily Sec7 domain 4.84e-80
Family Sec7 domain 0.00000000964
Further Details:      
 
Domain Number 2 Region: 259-380
Classification Level Classification E-value
Superfamily PH domain-like 1.73e-34
Family Pleckstrin-homology domain (PH domain) 0.000000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3KV34
Sequence length 394
Comment (tr|I3KV34|I3KV34_ORENI) Cytohesin 3 {ECO:0000313|Ensembl:ENSONIP00000024980} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=CYTH3 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MDEDNHVPEDLSVEERDELSNIRRRKRELLDDIERLKFEIAEVMTEIEQLTCVGESKTSQ
RNKQIAMGRKKFNMDPKKGIQFLLENDLLQHTPEDIAQFLYKGEGLNKTVIGDYLGERDD
FNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCQCNPGVFQ
STDTCYVLSFAIIMLNTSLHNPNVRDKPPVERFISMNRGINEGGDLPEELLRNLYDSIKN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPR
GIIPLENLSIREVDEPRKPNCFELYNPNHKGQVIKACKTEADGRVVEGNHVVYRISAPTP
EEKEEWIKSIKASISRDPFYDMLATRKRRIANKK
Download sequence
Identical sequences I3KV34
ENSONIP00000024980 ENSONIP00000024980 XP_004562401.1.88231 XP_005448193.1.78416 XP_006801015.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]