SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KVP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KVP7
Domain Number 1 Region: 178-446
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-83
Family Nuclear receptor ligand-binding domain 0.00000000247
Further Details:      
 
Domain Number 2 Region: 126-206
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-30
Family Nuclear receptor 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3KVP7
Sequence length 452
Comment (tr|I3KVP7|I3KVP7_ORENI) Retinoid x receptor, beta a {ECO:0000313|Ensembl:ENSONIP00000025193} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100534499 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
SSCCLLSDSHSPDSSSVSSPPSGQRSPPLVPSAASMTSLPPITSAGVNSPISSIGSPFSV
ISSSLGSPCLPGTPSVGYGPISSPQINSTVSMSGLHAVSSSDDVKPPLGLKQLSSHSPGP
MLSQKRLCSICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCTVDKRQRNRC
QYCRYQKCLAMGMKREAVQEERQRNKDRDGEVESTSAVNEEMPVEKILEAEMAVEQKTEL
HADGSSGGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLI
ASFSHRSISVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCL
RAIILFNPDAKGLSNPSEVELLRERVYASLEAYCKQKYPDQQGRFAKLLLRLPALRSIGL
KCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLT
Download sequence
Identical sequences I3KVP7
ENSONIP00000025193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]