SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KX42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KX42
Domain Number 1 Region: 372-422
Classification Level Classification E-value
Superfamily UBA-like 0.000000000442
Family UBA domain 0.0009
Further Details:      
 
Domain Number 2 Region: 454-490
Classification Level Classification E-value
Superfamily UBA-like 0.00000766
Family UBA domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3KX42
Sequence length 494
Comment (tr|I3KX42|I3KX42_ORENI) Ubiquitin associated protein 1 {ECO:0000313|Ensembl:ENSONIP00000025688} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MAARKSGSVWTGPISYLDDVPFKINDKFRCPAKVGLPVGFSLPDFGSVLADTKYDFSLEK
RSVRWGAEQAEAIAAEARAEEAAAKQEAESRKRLAKAQEVDGGGGKKPQSPAEDQDLPPP
ALNPVLAGLSHNAILTPLPAPSFDHRNTQPSTPQLHSLNLADFEREEDPFDKLELKTLDD
KEELRNILQSQPQPQAQPQPQHPPSVSPPEISQLGPTSRGNSPSPPSINTSLSSKPGFAH
KPNGLVAFLDMDRVGHPGRAAFDTDDRPCNIRSLTFPKLSDSGDPEPLRYTPLPTTVPAP
RQNLPNGSSPTIPKAEVIVAPELASHTKSGTPKPKTAELKIKKMPKLCFVSGPKTIHCVR
ADCGRSGSAGLPCGGALLSMTPNERQCVETLVGMGYSYEGVLRAMQRQGQNMEQVLDYLF
VHGRLCERGFDESAVEECLEMYQCSEEKALQFLELMSRFGEMGFERDTIKEVLLVHNNDQ
DKALEDLMARATAS
Download sequence
Identical sequences I3KX42
ENSONIP00000025688 ENSONIP00000025688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]