SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KYY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KYY3
Domain Number 1 Region: 378-548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-50
Family SPRY domain 0.00053
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 6.63e-20
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 144-202
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000183
Family B-box zinc-binding domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KYY3
Sequence length 556
Comment (tr|I3KYY3|I3KYY3_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000026330} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100695670 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MAQRLNQLDSEKFSCSICLELLQNPVTIPCGHSYCLNCIKTHFDEEDRKQIHTCPQCRKT
FTPRPILEKNILLAELVEDLNKTGPQAVLADHCYAGPEDVSCDVCTGTKLKASKTCLVCL
VSYCRKHLQPHHDVIQLSKHTLAGPFKKLQGNICFRHNEVMKIFCRTDQQTVCYLCLLDE
HKGHETVPAATERTEKQKELEVRRLKIQQSIQNREKDVKLLQQQVEAIISSADKTVVDSE
KMFTELIHLIQKRSSDVKQQVRSKQETEVNRVKEVLEKLEKEIAELKRKDAELEQLSHTE
DHNQFLHNYPSLSTLTDSTPSSSISICPQRYFENVTAALSEARDKLQEFLREKWTNSSLK
VTEKDALLSLPEPKTRAGFLKYSSEITLDPNTAFPHMLLSEGNRKATRVKQKQAYFHHPD
RFTVWEQVLSRESLTGRCYWEVEWRGGGVGVAVAYKNIRRTGKSYECLFGFNDKSWALCC
DTNSYVFWHNNVQTKLSGPRSFRVGVYLDHSAGILSFYSISETMTLLHRIQTTFTQPLSV
GLWLWVDGVTAELIQI
Download sequence
Identical sequences I3KYY3
ENSONIP00000026330 ENSONIP00000026330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]