SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KZS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KZS9
Domain Number 1 Region: 381-546
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-48
Family SPRY domain 0.00042
Further Details:      
 
Domain Number 2 Region: 11-82
Classification Level Classification E-value
Superfamily RING/U-box 1.41e-18
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 142-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000198
Family B-box zinc-binding domain 0.00088
Further Details:      
 
Weak hits

Sequence:  I3KZS9
Domain Number - Region: 186-319
Classification Level Classification E-value
Superfamily t-snare proteins 0.0337
Family t-snare proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KZS9
Sequence length 560
Comment (tr|I3KZS9|I3KZS9_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000026626} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100709791 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MAQHKNLMDKEKFCCSICLDLLTDPATIPCGHSYCMNCIKTQWDSEDTKQIHSCPQCRQT
FTPRPALVKSTMLADLVDELKKIGLQAAPSDHSYAEPEDVACDFCTGVKLKAIKSCLVCL
ASYCEKHLQPHYDSLTFKKHKLVEPSKKLQDNICSRHDEVMKIYCRTDHQSICYLCSMDE
HKGHNTISAAAERTERQKELEVSQENIQQRIQDKEKDVKLLQHEVEAISRSADKAVEESE
KIFTELICLIQKSCSDVKQQIRSQQETEVSRVKELQEKLEMEITELKRKDTELKELLNTE
DHNQFLQNYLSLSALTESTESSSINMRPLGYFEVVTTAVAEVRDKLQHILREKCTDISLI
VTEVDVLLSDPQAEPKTRAGFLKLSREMTLDPNTANTWLLLSERNRKTTAMNNQQPYSDH
PDRFTDYWQVLSTDRLTGRCYWEVEWRGGVHVAVAYKNINRVGMGNECGFGGNARSWALK
CSQNSYTFWHNNIQTLISGPQSSRIGVYLDHSAGILSFYSISETMTLLHRVQTTFTQPLH
AGLRLNGWFVFGASAKFCKL
Download sequence
Identical sequences I3KZS9
ENSONIP00000026626 ENSONIP00000026626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]