SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3L0R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3L0R8
Domain Number 1 Region: 10-192
Classification Level Classification E-value
Superfamily Rhomboid-like 2.35e-17
Family Rhomboid-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3L0R8
Sequence length 200
Comment (tr|I3L0R8|I3L0R8_HUMAN) Derlin {ECO:0000256|RuleBase:RU363059} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=DERL2 OC=Catarrhini; Hominidae; Homo.
Sequence
MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITN
FLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTQSDRMSKSKEL
LTQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVG
HIYFFLEDVFPNQPGGIRIL
Download sequence
Identical sequences A0A2J8KQD3 A0A2J8R7T0 I3L0R8
ENSP00000458296 ENSP00000458296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]