SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3L380 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3L380
Sequence length 118
Comment (tr|I3L380|I3L380_HUMAN) Monoacylglycerol lipase ABHD12 {ECO:0000313|Ensembl:ENSP00000460249} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ABHD12 OC=Catarrhini; Hominidae; Homo.
Sequence
MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEPRCAADAGMKR
ALGRRKGVWLRLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFGPCAPSQLEDFLC
Download sequence
Identical sequences A0A2I3TQ34 I3L380
ENSP00000460249 ENSP00000460249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]