SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3L440 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3L440
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.11e-24
Family Atu1826-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3L440
Sequence length 105
Comment (tr|I3L440|I3L440_HUMAN) Monoacylglycerol lipase ABHD12 {ECO:0000313|Ensembl:ENSP00000460950} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ABHD12 OC=Catarrhini; Hominidae; Homo.
Sequence
MWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSE
RGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCER
Download sequence
Identical sequences A0A2J8KX57 I3L440
ENSP00000460950 ENSP00000460950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]