SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3L6R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3L6R7
Domain Number 1 Region: 527-876
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.11e-115
Family Hect, E3 ligase catalytic domain 0.00000000843
Further Details:      
 
Domain Number 2 Region: 20-156
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.54e-30
Family Synaptotagmin-like (S variant) 0.039
Further Details:      
 
Domain Number 3 Region: 472-512
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000275
Family WW domain 0.00012
Further Details:      
 
Domain Number 4 Region: 183-225
Classification Level Classification E-value
Superfamily WW domain 0.000000000000209
Family WW domain 0.001
Further Details:      
 
Domain Number 5 Region: 422-458
Classification Level Classification E-value
Superfamily WW domain 0.000000000000742
Family WW domain 0.00093
Further Details:      
 
Domain Number 6 Region: 342-382
Classification Level Classification E-value
Superfamily WW domain 0.00000000000139
Family WW domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3L6R7
Sequence length 883
Comment (tr|I3L6R7|I3L6R7_PIG) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=NEDD4 OC=Sus.
Sequence
MATCAVEVFGLPEDEENSRIVRVKVIAGIGLAKKDILGASDPYVRVTLYDPMNGVFTSVQ
TKTIKKTLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRM
ERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEEDNTEQAEELEPGWVVLDQPDA
ACNLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPSLQDTLTDAENGNIQLQA
QRAFTTRRQISEETESVDSRESSENWEIIREDEATMYSNQAFPSSPPSNNLDVQTHLAEE
LNARLTVCGNSATGQPVSSSNHSSRRSSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDE
RGRSYYVDHNCRTTTWLKPTLQASVTTETSQLPSSQSSSTGPQAQAPTSDAAQQVTQPSE
MEQGSLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDPSSDLGPLPP
GWEERTHTDGRIFYINHNIKKTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQN
DIPNKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLIS
KEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFI
RPFYKMMLHKTITLHDMESVDGEYYNSLRWILENDPTELDLRFVIDEELFGQTHQHELKN
GGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKELLMCGLGDVDVNDWREHTKYKNG
YSVNHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGT
PEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD
Download sequence
Identical sequences I3L6R7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]