SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3LDN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3LDN7
Domain Number 1 Region: 118-200
Classification Level Classification E-value
Superfamily DEATH domain 0.000000447
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3LDN7
Sequence length 205
Comment (tr|I3LDN7|I3LDN7_PIG) Uncharacterized protein {ECO:0000313|Ensembl:ENSSSCP00000022169} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=EDARADD OC=Sus.
Sequence
MASPDDPLRADHLAKEPVEDTDPSTISLNMSDKYPIQDTGLPKAEECDPVALNCPTNSDM
QHQGEENGFPDSTRDPLSDLSKVEPCAKKCTCSSCSLRAPTISDLLNDQDLLDVIRIKLD
PCHPTVKNWRNFASKWGMPYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRAD
VEKVLRRWVDEEWPKRSREDHPRNV
Download sequence
Identical sequences I3LDN7
ENSSSCP00000022169 NP_001230592.1.46622 ENSSSCP00000022169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]