SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3LP64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3LP64
Domain Number 1 Region: 42-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.95e-34
Family SCAN domain 0.0000938
Further Details:      
 
Domain Number 2 Region: 842-898
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 786-842
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 883-935
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-16
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 5 Region: 738-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000833
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  I3LP64
Domain Number - Region: 250-286
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0157
Family KRAB domain (Kruppel-associated box) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3LP64
Sequence length 969
Comment (tr|I3LP64|I3LP64_PIG) Zinc finger with KRAB and SCAN domains 2 {ECO:0000313|Ensembl:ENSSSCP00000025889} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=ZKSCAN2 OC=Sus.
Sequence
MAASLDPQIHASLEAEGCLIMKVEKEPEWASEPILEGSDGSECETFRKCFRQFCYDDVTG
PHEAFSKLWELCCRWLKPEMRSKEQILELLVIEQFLTILPEKIQAWAQKQCPESGEEAVA
LVIHLEKENRRLRQQVSSPVHSEKQVPVGAAWEVADFEPEQVETQPRLMSQEEVERLHSG
HQEPLNQKRELRPLPKNAQPSPWVPAPADDWNTMAQEVTATQLPVGSQRPGKDIHMARGF
PYKKSVHQIPAHRDLCGDIRKESVGNMVSLGSTVTTSNKIPRVEQRKEPWTIGLHSSSKR
NILRSSYVKEKPVPALQVPARNAGKTWREQQQWGLEDEKIAGVHWSYEETKTFLAILKES
RFYETLQACPRNSQVYGAVAEWLRECGFLRTPEQCRTKFKSLQKSYRKVRNGHVLEPCAF
FEDMDALLNPTAHASSTDKPKEILSLPRLKRISISAKERINLVEEEDAAEESDGDEMGVE
FIRKSELHGAPVLFQNLSGVHWGYEETKTFLEILRETRFYEALQACHRKSKLYGAVAEQL
RECGFLRTPEQCRTKFKSLQKSYRKVKNGHVLESCAFYKEMDALINSRVPAPPAGTPEEV
PSPSFQEREDIEIEPQEPVGWEPEEASQEAVVEDSGSERMSEEEIVQEPEFLGPPGLLQS
PHDFEIGSSFNEDATQVIYKDLEQHRALIEKAKRVVSQNADPGKHHKRECISGRQWENLQ
GIRQGKPMAQPRDLGKAVVHQRPFLGKRPYRLLRYGEGFGRSARLLCRMPHQKENPYKCS
VCGKCFGRSRSLIRHQRIHTGEKPFKCLDCGKSFNDSSNFGAHQRIHTGEKPYRCGECGK
CFSQSSSLIIHQRTHTGEKPYQCGECGKSFTNSSHFSAHRRVHTGENPYKCADCEKSFNN
CTRFREHRRIHTGEKPYGCAQCGKRFSKSSVLAKHREVHTREKLLPHPPALYSPENPQKG
KTDQFRTSF
Download sequence
Identical sequences I3LP64
ENSSSCP00000008351 ENSSSCP00000025889 XP_003124584.4.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]