SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3LVU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3LVU3
Domain Number 1 Region: 223-465
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.84e-51
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 63-177
Classification Level Classification E-value
Superfamily POZ domain 6.54e-28
Family Tetramerization domain of potassium channels 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3LVU3
Sequence length 514
Comment (tr|I3LVU3|I3LVU3_ICTTR) Potassium voltage-gated channel modifier subfamily G member 1 {ECO:0000313|Ensembl:ENSSTOP00000000015} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=KCNG1 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MTLLPGDNSDYDYSALSCTSDASFHPAFLPQSQSLKGVFYRRAQRLRPQDGPCPGGPAGD
RRRRIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRN
PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCRRRYLQKIEEFAEMV
EQEDEEDPLDSEGRDSEGPARAEGRLGRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT
AVNLSVSTLPSLREEEEQGQCSQMCRNVFIVESVCVGWFSLEFLLRFIQAPSKFAFLRSP
LTLIDLVAILPYYVTLLVDGAASGRRKPGNSNSYLDKVGLVLRVLRALRILYVMRLARHS
LGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI
TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVMFR
RAQFLIKTKSQLSGMSQDSDILFGSASSDTRDNN
Download sequence
Identical sequences I3LVU3
ENSSTOP00000000015 ENSSTOP00000000015 XP_005325269.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]