SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3LXG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3LXG2
Domain Number 1 Region: 434-563
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000141
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 625-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000718
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 659-700
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000041
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 4 Region: 727-853
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000879
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 5 Region: 370-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000314
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 334-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000172
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 293-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000672
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 704-738
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3LXG2
Sequence length 1214
Comment (tr|I3LXG2|I3LXG2_ICTTR) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=JAG1 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MQSPRTRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGSRN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRI
VLPFSFAWPVSDRLREGSRAEAQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIR
VTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNKAICRQGCSPKHGS
CKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQ
PCLNGGTCSNTGPDKYQCSCPEGYSGANCEIAEHACLSDPCHNKGSCKETSLGFECECSP
GWTGPTCSTNINDCSPNNCSHGGTCLDLVNGFKCVCPPQWTGKTCQLDANECEDKPCVNA
KSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYAGDHC
ERDIDECASNPCLNGGHCQNEINKFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRA
SDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGK
CKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCKNGGTCIDGINSYKCICSDGWEGAFC
ETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEG
DAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGETFTCVCKEGWEGPICTQNTN
DCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYQC
VCPPGHSGAKCQEVSGRPCITIGRVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPRPCLL
HKGHSECPSGQSCIPILDDQCFVRPCTGVGECRSSSLQPVKTKCTSDSYYQDNCANITFT
FNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSLLANNEIHVAISAEDIRDD
GNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVAWVCC
LVTAFYWCLRKRRKPSSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYENKNS
KMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKAPNGTPTKHPNWTNKQDNRD
LESAQSLNRMEYIV
Download sequence
Identical sequences I3LXG2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]