SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3M333 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3M333
Domain Number 1 Region: 7-248
Classification Level Classification E-value
Superfamily Caspase-like 7.59e-51
Family Caspase catalytic domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3M333
Sequence length 250
Comment (tr|I3M333|I3M333_ICTTR) Uncharacterized protein {ECO:0000313|Ensembl:ENSSTOP00000003436} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN= OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
ALLLAVIQDRPGAQHDVKALGDLCRALGFKITLRMDPTAQGFQAELAQFRERLDTCRGPV
SCALVALMAHGGPQGQLLGADGQEVQPEALVQELSHCRALRGRPKIFLLQSCRGGNRDAG
VGPVALPWYWRWLRTPLAIPTQADVLQIHTDAQGSPSRDPIPGSSDQADILTVYAATEGC
VAYRDEKGSDLIQTLVEVLRANPRGDLLELLTEVNRRVCELDVLGPDCNELRKACLEIRS
SLRRRLCLQA
Download sequence
Identical sequences I3M333
ENSSTOP00000003436 ENSSTOP00000003436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]