SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3MA87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3MA87
Domain Number 1 Region: 523-553,659-736
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000267
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3MA87
Sequence length 790
Comment (tr|I3MA87|I3MA87_ICTTR) Anion transporter/exchanger protein 9 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=SLC26A9 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MSQPRPRYVVDRTAYSLTLFDDEFEKKDRPYPVGEKLRNAFSCSSAKIKAVVFGLLPVLS
WIPKYKIKDYIIPDLLGGLSGGCIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGV
HQMVPGTFAVISILVGNICLQLAPESKFRVFNNATNESYVDTAAMETERLHVSATLACLT
AIIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYAGPGSIVFT
FIDICKNLPHTNIASLIFALISGAFLVLVKELNARYMHKIRFPIPSEMIVVVVATAISGS
YKMPRKYHMQIVGEIQSGFPAPVSPVVSQWKDMIGTAFSLAIVGYVINLAMGRTLASKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLYPLPKAVLGALIAVNLKTSLKQLTDPYYLWRKSKLDCCVWVVSFLSSFFLSLPY
GVAVGVAFSVLVVVFQTQFRNGYALAQVMDTDIYVNPKTYNRVQEIEGIKIVTYCSPLYF
ANSEIFRQKVVAKTGMDPQKVLLAKQKYLRKQEKRMMPTQHRKSLFMKTKTVSLQELQQD
FENASPTDPNNNQTPANGASISYITFSPDTSSAAPCEPSASAGSPSEPSDTLASVPPFVT
FHTLILDMSGVSFVDLMGIKALGKLSSTYGKIGVKVFLVNIHAQVYKDISHGGVFEDGCL
ERNHIFPSIHDAVLFAQANAREVAPGHSFQGAPGATELSLYDSEEDGPSYWDLEQEMFGS
MFHAETLTAL
Download sequence
Identical sequences I3MA87
XP_005329550.1.77405 ENSSTOP00000006884 ENSSTOP00000006884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]