SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3MDL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3MDL7
Domain Number 1 Region: 493-731
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000995
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 
Domain Number 2 Region: 44-71
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000249
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3MDL7
Sequence length 881
Comment (tr|I3MDL7|I3MDL7_ICTTR) Poly(A)-nuclease deadenylation complex subunit 3 {ECO:0000256|HAMAP-Rule:MF_03181} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=PAN3 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MNSGGGLPPPSAAASPSSSSLAAAVAVVAPPGVGGVPGGAAAGVKLKYCRYYAKDKTCFY
GEECQFLHEDPAAGAAPSLGLHSNSVPLALAGAPVAGFPPGAVPGGGAGPPPGPKKPDLG
GPGPGATGGGLDGARLAIPGMDGGALTDTSLTDSFFSTSFIGVNGFGSPVETKYPLMQRM
TNSSSSPSLLNDSAKPYAGHDALSSPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPM
GSKARKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGSTSRLSNV
SQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP
ASYMVPSSASTPVNNAVSQTPSSGQVIQKETVGGTTYFYTDTTPAPVTGMVFPNYHIYPP
TAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYHSLFPLE
PLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMWKKIQHS
NIVTLREVFTTKAFSEPSLVFAYDFHAGGETMMSRHFNDPNADSYFTKRKWGQHDGPLPR
QHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVGVFDVLT
FDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTINYSSDLK
NLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAK
LGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGV
PEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL
Download sequence
Identical sequences I3MDL7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]