SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3MJT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3MJT9
Domain Number 1 Region: 56-194
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000594
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3MJT9
Sequence length 217
Comment (tr|I3MJT9|I3MJT9_ICTTR) Phosphotyrosine interaction domain containing 1 {ECO:0000313|Ensembl:ENSSTOP00000011472} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=PID1 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MWQPATERLQHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKARTHSGCKV
TYLGKVSTSGMQFLSGCTEKPVIELWKKHTLAREDVSPANALLEIRPFQVWLHHLDHKGE
ATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAH
AMMEAFKKTFHSMKSDGRIHRDSSSEEVSQELESDDG
Download sequence
Identical sequences I3MJT9
XP_005326512.1.77405 ENSSTOP00000011472 ENSSTOP00000011472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]