SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3MKE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3MKE9
Domain Number 1 Region: 36-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.69e-37
Family SCAN domain 0.0000471
Further Details:      
 
Domain Number 2 Region: 473-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.34e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 586-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 632-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 5 Region: 436-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 515-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000686
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 213-267
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000209
Family KRAB domain (Kruppel-associated box) 0.0051
Further Details:      
 
Domain Number 8 Region: 377-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000524
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3MKE9
Sequence length 686
Comment (tr|I3MKE9|I3MKE9_ICTTR) Zinc finger protein 263 {ECO:0000313|Ensembl:ENSSTOP00000011756} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=ZNF263 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
TAMASVPGSQEREGLLIVKLEEDCAWSQELPPPDPGPSQEASHLRFRRFRFQEAAGPREA
LSRLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVED
MQRELGRLRQQVTNQGRGTEVLLEEPLPLETAGESPSFKLEPMETERSPGPRLQELLGPS
PKRDPQAVKDRALSTPWLSLFPPEGNMEDKEMTGPQLPESIEDVAMYISQEEWGHQDPNK
RVLSRDTVQESYENVDSLESHIPSQEALNTQVEQGGKPWDPSVQSCKEGVSPRSAAPGEE
KFENPEGSSPSVSLENTHPQVLFPGQARGEVPWSPELGRPHDRAEGHWEPPPEDRTEQSL
AGATGCRELVRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAEKLCMGVECGEVFGG
HPHFMSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCSVCGKSFSCNSNL
HRHQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCAECGKSFSRSSHLVIHE
RTHEKERLDPFSECGEAMSDSAPFLTNHGAHRAEKKLFECLTCGKSFRQGMHLTRHQRTH
TGEKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGER
PYKCSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences I3MKE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]