SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3MPJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3MPJ8
Domain Number 1 Region: 372-479
Classification Level Classification E-value
Superfamily Anthrax protective antigen 4.32e-19
Family Anthrax protective antigen 0.012
Further Details:      
 
Domain Number 2 Region: 1830-1910
Classification Level Classification E-value
Superfamily E set domains 4.96e-16
Family E-set domains of sugar-utilizing enzymes 0.025
Further Details:      
 
Domain Number 3 Region: 2089-2178
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000747
Family Other IPT/TIG domains 0.054
Further Details:      
 
Domain Number 4 Region: 3192-3221,3255-3376,3405-3519
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000134
Family Galacturonase 0.079
Further Details:      
 
Domain Number 5 Region: 1239-1319
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000204
Family E-set domains of sugar-utilizing enzymes 0.022
Further Details:      
 
Domain Number 6 Region: 1914-1997
Classification Level Classification E-value
Superfamily E set domains 0.000000000000035
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 7 Region: 1157-1234
Classification Level Classification E-value
Superfamily E set domains 0.000000000000035
Family E-set domains of sugar-utilizing enzymes 0.015
Further Details:      
 
Domain Number 8 Region: 2000-2086
Classification Level Classification E-value
Superfamily E set domains 0.00000000000057
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.028
Further Details:      
 
Domain Number 9 Region: 1066-1142
Classification Level Classification E-value
Superfamily E set domains 0.00000000000111
Family E-set domains of sugar-utilizing enzymes 0.026
Further Details:      
 
Domain Number 10 Region: 1661-1743
Classification Level Classification E-value
Superfamily E set domains 0.00000000000624
Family E-set domains of sugar-utilizing enzymes 0.062
Further Details:      
 
Domain Number 11 Region: 272-335
Classification Level Classification E-value
Superfamily E set domains 0.000000000121
Family E-set domains of sugar-utilizing enzymes 0.032
Further Details:      
 
Domain Number 12 Region: 1563-1629
Classification Level Classification E-value
Superfamily E set domains 0.00000000035
Family E-set domains of sugar-utilizing enzymes 0.022
Further Details:      
 
Domain Number 13 Region: 1748-1825
Classification Level Classification E-value
Superfamily E set domains 0.00000000266
Family E-set domains of sugar-utilizing enzymes 0.054
Further Details:      
 
Domain Number 14 Region: 1331-1387
Classification Level Classification E-value
Superfamily E set domains 0.000000008
Family E-set domains of sugar-utilizing enzymes 0.018
Further Details:      
 
Domain Number 15 Region: 143-241
Classification Level Classification E-value
Superfamily E set domains 0.0000000342
Family E-set domains of sugar-utilizing enzymes 0.026
Further Details:      
 
Domain Number 16 Region: 33-124
Classification Level Classification E-value
Superfamily E set domains 0.0000000522
Family E-set domains of sugar-utilizing enzymes 0.032
Further Details:      
 
Domain Number 17 Region: 2350-2404,2456-2683
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000014
Family Galacturonase 0.071
Further Details:      
 
Domain Number 18 Region: 1406-1499
Classification Level Classification E-value
Superfamily Cupredoxins 0.00000229
Family Plastocyanin/azurin-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3MPJ8
Sequence length 4254
Comment (tr|I3MPJ8|I3MPJ8_ICTTR) PKHD1 like 1 {ECO:0000313|Ensembl:ENSSTOP00000013727} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=PKHD1L1 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MGHLWLLGTWGLWALLLRAADPHTDDSEVIPKVMEVLPKYGSINGATRLTIKGEGFSQAN
QFDFGVDNAELGNSVQLVSSFRSITCDVEKDSSHSTQITCYTRAMPEDSYTVRVSVDGIP
IAENNTCKGHINSWACSFNAKSFRTPTIMSITPLSGTPGTLITIQGRIFTDVYGSNTALS
SNGKNVRILRVYNGGMPCELLIPQSDNLYGLKLDHPNGDIGSMTCKITGTYIGHHNVSFI
LDSDYGRSFPQKMAYFVSSLNKISMFQTYAEVTTVSPSKGSTGGGTTLTISGRFFDQTDL
PVKVLVGGQTCDILNITENSIYCKTPPKPPILKTVYPGGRGLKLEVWNNSRPLHLEEILG
YNEKTPGYMGASWVDSASYAWPMGQDTFVARFSGFLVAPDSDVYRFYIKGDDRYAIYFSQ
TGLPEDKVRIAYHSANANSYFSSPTQRSDDIHLQKGKEYYIEILLQEYRLSAFVDVGLYQ
FRNVYTEQQTRDAINEEQVIKSQSTIIQEVQVITLENWETTNATNEVQKITVTSPCVGAN
SCSFHQYRLIYNMEKTILLPADASGSLMQSALNDLWSVKPDTVQVIRKRNLQSFIYTITF
VSTRGDFDLLGYEVLEGNNVTLDITEQTKGKPSLETFTLNWDGIASVPLTPASSEVEFQA
AVEEMVSTKCPPQIAHFEEGFVVKYFRDYETYFDLEHINRGQKTAETDAYCGRYSLKNPA
VLFDSTDVKPNRSPYGNILLFPYNQLCLAYKGFLKNYIGLKFQYQDNGKITRSADIQFTY
NFAYGNNWTYTCIDLLDLIQTKYEGTDFSLQRISLQKASESQFFYVDVVYIGQTSTISTL
VEMPKRRLPALANKGIFLKHFQVNQSKINGSTITIQYFIIMTSYNCSHNIPLMAVSFGQV
ITNETENESVYRGKNWPGKSKIHIQRIQEASPPISGTFDIYAYGHVLKGIPAAVSAADLQ
FALQSLEEVGQVSVTQEGTCAGYSWSIKWRSTCGRQNLLQVNDSNITGEKANVTVAKVRE
GGLFRRHILGDLLRTPSQKPQVQVYVNGIPSKCSGDCRFTWDPMSTPLISATSPSQGSYE
DSTILTIAGSGFSPSSAVSVSVGPTSCSLLSVNENEIKCQILNGSAGHVPVAVSIADVGL
AQNVEGEGFHFIYESRISHIWPDSGSLAGGTLLTVSGFGFSENSKVLVGNETCSVTEGNL
NKITCRTPKRIEGTVDISVITNGFQTTAKDVFSYNCLQTPVITDFSPKVRTILGDVNLTI
KGYNFGNELTQNMVVYVGGKPCQVLHWNFTDIRCLLPTLSPGKHDIHVEVRNWGFASTRD
KLNASIWYILKVTNMFPQRGSLYGGTEITVLGFGFSTIPMKNTVLLGSFPCNVTSSSENV
IKCILHSTGNVFRITNNGEDLVHGLGYAWSPSVLNVSVGDTVTWHWQAHPFLRGIGYRVF
SVSSPGSVIYDGRGFTNGRQKSLSGSFSYQFTSPGIHYYSSGYVDEANSTSLQGVINVLP
AQTRHIPLHLFVGSTEATYAQGGPENLHLESSVAGCLATEPLCGLNNIKVKNSNRPFFEL
SSCNSPSISNITPSTGTVNELITISGHGFSNLTCANKVTIGSYPCVVEKSSENSIMCHID
PQNSMDVGIREIVTLIVYNLGTAINTLSKEFDRRFVLLPSIDMVLPSAGSTTGMTRVTIK
GSGFSASSAGVEVFMGHFPCKVLTVNYTVIECETSPAPQQLVHVDLLIHGVPAQCQGNCS
FSYSESITPYITGIFPNSIEGSVNVLIEGEGLGTVLEEIAVFIGNQQFRVTHVNEKNITV
LMTSLPAGPHSLSVVVGSKGLALGNLTVSSPAVASVSPKSGSIGGGTILRITGNGFYPGN
TTVTVGERPCQIVFVNSSEVYCSTPPGRAGKVDLKIFVNAITYPSLSFNYSLEDTPFLRG
IVPDRGLPGTEIEITGSNFGFDISEISVMLGDIQCNVTTVNDSMLQCVTGAHAGGTFPVL
MHHKTKGSAVSTVEFEYPLHIQNIHPTQGSFGGGRTMTVTGTGFNSQNSIVLVCGSECAI
DRLRSDYTTLLCEIPPHDGRGPEQACEVSVVNGKDSSLSVTPFTYMTSLTPLITEISPRR
GSTAGGTRLTVRGSGFSENTQDVHITIAEARCNVEFSNRTHIFCTTEAHTPSGWAPVHVN
IRDIGRATLDNADFLYVDAWSSNYSWGGKSPPEEGSLAIITKGQIILLDQSTPILKMLLI
QGGTLIFDEADIELQAENILITDGGTLQIGTEASPFQHKAVITLHGHLRSPELPVYGAKT
LAVREGVLDLHGLPVSVVWTRLAHTAKAGERILILQEAVTWKEGDKIVIASTGHRHSQRE
NEERTIESVSTDGKNITITNPLNYTHLGITVTLPDGTLFEARAEVGILTRNILIRGSDNI
EWNNKIPACPDGFDTGEFATQTCLQGKFGEEIGSDEFGGCIMFHAPLPDSNMVTGRIEYV
EVFHAGQAFRLGRYPIHWHLLGDLQFKSYVRGCAIHQTYNRAVTIHNTHHLLVERNIIYD
IKGGAFFIEDGIEHGNILQYNLAVFVQQSTSLLNDDVTPAAFWVTNPNNTIRHNAAAGGT
HFGFWYRMNDHPDGPSYDQNICQKRVPLGEFFNNTVHSQGWFGLWIFEEYFPMQTGSCTS
SVPVPAIFNSLTTWNCQKGAEWVNGGALQFHNFVMVNNYEAGIETKRILAPYIGGWGETN
GAVIKSAKIVGHLDELGMGSAFCTSKGLVLPFSEGLTVSSLHFMNFDRPNCVALGVTSIT
GVCNDRCGGWSAKFVDIQYFYTPNKAGFRWEHEAVLIDVDGSLTGHKGYTVIPHSSLLDP
SHCIQEDQWSIGFPGSVCDASVSFHRLAFNKPSPVSLLEKDVVLSDSFGTSIVPFQKKRL
THMSGWMALIPNANHINWYFKGVDHVTNISYTSTFYGFKEEDYVIISHNFTQNPDMFNVI
DMRNGSSNPLNWNTSKNGDWHLEANTSTLYYLVSGRRDLHPIEPISGTLDPDVKDVTINF
QAYCCILQDCFPVHPPSRTPTPRKRPATYNLWSNDSFWQSSQENNYTIPYPGANVVIPEG
TWIVADTDMPPMERLIIWGVLELEDKSNAGPAGPSYRRVVLNATYISVQGGRLIGGWEDN
PFKGELQIILRGNHSTPEWAFPEGPNQGAKVLGVFGELDLHGHPHSIYRTKLSETAEAGS
KVLSLAEAVDWQEGEEIVITTTSYDLHQTETRSIVKILHGNKILILNDTLAYTHLAERYQ
VPGTDQSYSLAADVGILTRNIKIIGEDYPGWIKDSFGARILVSSFTGNMMTFKGNARISN
VEFYHSGQDGYRDSTDPRYAVTFLNLGQIEDHGSSYIRGCAFHHGFSPAIGVFGTDGLDI
DDNIIHFTVGEGIRIWGDANRVRGNLVALSIWPGTYQNRKDLSSTLWHAAIEINKGTNTV
LQNNVVAGFGRAGYRIDGEPCSRKSNPMENWFGNEAHGGLYGIYMNQDGLPGCSLIQGFT
IWTCWDYGIYFQTTESVRIYNVTLVDNGMAIFSMIYMPAAVSHKISSKTVQVKSSLIVGS
SPEFNCSDVLTNDDPNIELTAAHRSSRPPSGGRSGICWPTFASAHNMSPRKPHAGIMSYN
AISGLLDVSDSTFIGFKNVCSGETNVIFITNPLNEDLQHPIHVKNIQLVDTIEQSKIFIH
RPDISKVNPSDCVDMVCDAKRKSFLKDIDGSFLGNSGSVIPQAEYEWNGNSQLGIGDYRI
PKVMLTFLNGSRIPITEKAPYKGIIRDSTCKYIPEWQSYQCFGMEYAMMVIESLDTDTET
RRLSPVAIISSGYVDLINGPQDHGWCAGYTCQRRLSLFHSIVALNKSYEVYFTGTSPQNL
RLMLLNVDQNKAVLVGIFYSTLQRLDVYVNNSLVCPKNTVWNTQQKYCKLNKHLHTEQFL
PHLDSTVLGENYFDRTYQMLYLLVKGNIPVEIYTATVIFVSFQLPAITEDDFYSSHNLVR
NLVLFLKIPSDKIRVSKILRGENMRRKRSTGGTIELEIGDPPTQFLSNDTTGQMQLYELQ
EIASSLGKATILGKTSSILGFNISSMSITNPIPSPKDPGWIKVTAKPVERSAFPVHHVAF
VSSLLVIAQPVAAQPGQPFSQQPSVKAVDSDGNCVSVGITSLTLKAMLKDSSNNLISGLS
GNTTIPFSSCWANYTDLTPLRTGKNFKIEFLLDNVARVESRTFSLLAQLVPGGSGSSTSS
GGSGSSSSSSSTTSAMATSAQLLTIVISFLMGRMLFLEIFMASVFLNVTIGSNY
Download sequence
Identical sequences I3MPJ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]