SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3MTR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3MTR1
Domain Number 1 Region: 1116-1292
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.61e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.00074
Further Details:      
 
Domain Number 2 Region: 678-793
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.09e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 434-565
Classification Level Classification E-value
Superfamily PH domain-like 7.19e-25
Family Pleckstrin-homology domain (PH domain) 0.0000115
Further Details:      
 
Domain Number 4 Region: 906-1031
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-22
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 5 Region: 1415-1555
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-21
Family Pleckstrin-homology domain (PH domain) 0.038
Further Details:      
 
Domain Number 6 Region: 5-74
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.5e-16
Family SAM (sterile alpha motif) domain 0.0000474
Further Details:      
 
Domain Number 7 Region: 577-677
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000257
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 8 Region: 1008-1108
Classification Level Classification E-value
Superfamily PH domain-like 0.000000182
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3MTR1
Sequence length 1696
Comment (tr|I3MTR1|I3MTR1_ICTTR) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSSTOP00000015506} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=ARAP2 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MSSVSEVNVDIKDFLMSINLEQYLLHFQEFGFYTVKDCAAINDSVLHKIGISPTGHRRRI
LKQLQIILSKMQEIPIYANVHKTKNGNNSKDHHHASSSDQNTCKELSNSGCIQIPSSTQL
ETFTKIFSMENNQSLESDVKLSLSNQDLPIPEEQHLGSSHESLLGSENIKIESLTAKKAV
DRTVEEQQAEKVDLISENFSNFPNTKPECLSSFDCSTSEANSGNGANGLLESSPPSPFFE
FQGEMVVNDLYVPSSPVSAPMRSRSKLVSRPSRSFLLRHRPVPEIPGPAKGISGSYFRER
RSATTLPGKSVTLQNSSEENSSSIFPYGETFLFQRLENSKKRCIKNEFWTHEETVKGEAP
TARNSFFIKSSIYDNKQEKLSEDKVEDIWIPREDKNNLPRDSASESEYSTVEECFQSLKR
KNSKASKSRTQKPLNSDPVNRHSYPLSSTSGNADSAVSSSAISPYACFYGSSAARVKSGW
LDKLSPQGKRMFQKRWVKFDGLSISYYNNEREMYSKGIIPISAVSTVRVQGDNKFEVVTT
QRTFVFRVEKEEERNDWISILLNALKSQSFTSQSQAAVAPEKCGYLELRGYKAKIFTVLK
GSNVWLCKNEQDFKSGLGITVIPMNVANVKQVDRTVKQSFEIITPYRSFSFTAESEKEKQ
DWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGEHR
SLGPKDSKVRSLKMDASIWSNELIELFIIIGNKRANDFWAGNLQKDEELHMDSPVEKRKN
FITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMAILFSGADVMCATGDPVHS
TPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEDGLNQDATQSVFLCDFLYQAPAAASK
VSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAVHKEDFYLNTGPI
FIFEIYLPSERVFLFGAETSQAQRKWTETIAKHFVPFVAENLTEADYDLIGQLFYKDCHA
LDQWRKGWFAMDKSSLRFCLQMQEAQEDRMHLRRLQELTISTMVQNGEKLDVLLLVEKGR
TLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGCKY
IYQKNGDPLRISELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDALLTKELYPY
WISALDTQDDKERTKKYGAFIRTLPGVNRATLAAIIEHLYRVQKCSEINHMNAHNLALVF
SSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGDL
LIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVIENEELERP
LHYTENVLEQVLRWSSLAEPGSAYLVVKKFLTMDVIKHHREKSIKEGVLKIKEEPSKILS
GNKFQDRYFVLRDGYLFLYKDPKSSKYDKMFPLSAMKFYLGVKKKMKPPTSWGLTAFSEK
HHWHLCCESSHTQMEWMASIFIAQHEDDIWPPAGKERKRSITKNPKIGGLPLIPIQQEAN
ATQAQRSFESAKAELERLRLSEKRDREFMDPSLKDRASIVAQCLEHKEDKLRNRTRKHRS
FNCLEDTESEVPRGHQKGHKGLKTLGKADDRNSKAALDTDHKLPSQVIEELSVVLQRSRT
LPKELQGEQILQKEIK
Download sequence
Identical sequences I3MTR1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]