SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3MTZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3MTZ3
Domain Number 1 Region: 525-867
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 9.68e-112
Family Hect, E3 ligase catalytic domain 0.000000012
Further Details:      
 
Domain Number 2 Region: 20-157
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.28e-29
Family Synaptotagmin-like (S variant) 0.056
Further Details:      
 
Domain Number 3 Region: 470-510
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000314
Family WW domain 0.00012
Further Details:      
 
Domain Number 4 Region: 182-224
Classification Level Classification E-value
Superfamily WW domain 0.000000000000181
Family WW domain 0.0012
Further Details:      
 
Domain Number 5 Region: 342-382
Classification Level Classification E-value
Superfamily WW domain 0.000000000000835
Family WW domain 0.0019
Further Details:      
 
Domain Number 6 Region: 423-456
Classification Level Classification E-value
Superfamily WW domain 0.00000000000292
Family WW domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3MTZ3
Sequence length 868
Comment (tr|I3MTZ3|I3MTZ3_ICTTR) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=NEDD4 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MATCAVDVFGLLEDEENSRIVRVKVIAGIGLAKKDILGASDPYVRVTLYDPMNGIFASVQ
TKTVKKSLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRM
ERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEEDNAEQAEELEPGWVVLDQPDA
ACHLQQQQEPSPLPPGWEERQDVLGRTYYVNHESRRTQWKRPTPQDDLTDAENGNIQLQA
QRAFTTRRQISEETESVDNRDSSENWEIIREDEAATYSSQAFPAPPLASNVDVQTHLAEG
LNARLTICANSATSPTASCSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDE
RGRSYYVDHNSRTTTWTKPSAQATMETSQLPSSQSPSAGPQAQLSLSDSAQQTTQPSEIE
QGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDSSSDLGPLPPGW
EERTHTDGRIFYINHNIKRTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQNDI
PNKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKE
MFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRP
FYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGG
SEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCG
LGDVDVNDWKEHTKYKNGYNVNHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFA
ELYGSNGPQSFTVEQWGTPEKLPRAHTW
Download sequence
Identical sequences I3MTZ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]