SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3MUM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3MUM3
Domain Number 1 Region: 538-566,610-690
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.67e-16
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3MUM3
Sequence length 704
Comment (tr|I3MUM3|I3MUM3_ICTTR) Solute carrier family 26 member 1 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=SLC26A1 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MEAAPESPQQGRGLVLVRRQPPAQKGPLERLKARLWRSCTCSVPRAWALVQSLVPATCWL
REYRPREDLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VNVGIFSLLCLMVGQVVDRELQLAGFDPSQDGLGPQGNSSILNSSTTSLVLGPPGCGRDC
HAIRVATALTLVAGIYQVLMGVLRLGFVSTYLSQPLLDGFAMGASVTILTSQLRHMLGVR
VPRHQGPGMVISTWLSLLRSLAQANLCDVATSAVCLAVLLAAKELSDRCRHRLKVPLPTE
LLVIVVATLVSHFGQLHRRFGSSVAGDIPTGFVAPQAPDPRLMQRVALDAVSLALVGSAF
SISLAEMFARSHGYSVRANQELLAVGCCNVLPAFFHCFATSAALSKSLVKTATGCRTQLS
SVVSAAVVLLVLLVLAPLFWDLQRSVLACIIVVSLRGALRKVRGLPRLWRLSPADALVWV
ATAATCVLVTTEAGLLAGVLLSLLSLAGRTQRPRAALLARIGDSAFYEDATEFEGLVPQP
GVQVFRFAGPLYYANKDFFLRSLYSLTGLDAGRSAATRRERGSEMGAGEGEPVDGKDLGS
MTSRARLVPMVTGFHTVVIDCAPLLFLDVAGMATLKDLRRDYWALGVTLLLACCNPSVRD
SLKRGGFLSEDQGPEDEQLFPSVHSAVEAARARRGELVVPDSAL
Download sequence
Identical sequences I3MUM3
ENSSTOP00000015818 ENSSTOP00000015818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]