SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3MWX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3MWX4
Domain Number 1 Region: 72-119
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000562
Family Elafin-like 0.00045
Further Details:      
 
Domain Number 2 Region: 29-72
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000275
Family Elafin-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3MWX4
Sequence length 121
Comment (tr|I3MWX4|I3MWX4_ICTTR) WAP four-disulfide core domain 2 {ECO:0000313|Ensembl:ENSSTOP00000016619} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=WFDC2 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MPVPRLCALAAALLLGLLLLGLPPATGAGERAGVCPQLPADVNCTKECLSDSDCADYRKC
CHAGCGTVCSIPNEKPGSCPNVDLPQLGICQDQCQEDSQCTGPMKCCRNGCGKVSCVTPD
P
Download sequence
Identical sequences I3MWX4
XP_005325323.1.77405 ENSSTOP00000016619 ENSSTOP00000016619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]