SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3MXX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3MXX1
Domain Number 1 Region: 213-461
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-58
Family Voltage-gated potassium channels 0.00046
Further Details:      
 
Domain Number 2 Region: 86-183
Classification Level Classification E-value
Superfamily POZ domain 7.59e-25
Family Tetramerization domain of potassium channels 0.00000744
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3MXX1
Sequence length 511
Comment (tr|I3MXX1|I3MXX1_ICTTR) Potassium voltage-gated channel subfamily A member 10 {ECO:0000313|Ensembl:ENSSTOP00000016966} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=KCNA10 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDPSNPKGRPGSSPFSNWKILISDSTNLE
TTFSKLPGDYADPPGPEPLVWNEGNQRVIINIAGLRFETQLRTLNQFPETLLGDREKRMQ
FFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDIFADEISFYELGSEAMDQFR
EDEGFIKDPETRLPTNEFHRQFWLLFEYPESSSAARGVAVVSVLVVVISITIFCLETLPE
FREDRELKVVRDPRLHANKTDLSQTMFSDPFFMVESTCIMWFTFELVLRFVVCPSKTDFF
RNLMNIIDIISIIPYFATLITELVQETEPSNQQNMSLAILRIIRLVRVFRVFKLSRHSKG
LQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMT
TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPGEI
DKILNSVGSRTGSTDSLNKTNRGCASEKSRK
Download sequence
Identical sequences I3MXX1
ENSSTOP00000016966 XP_005338179.1.77405 ENSSTOP00000016966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]