SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3N129 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3N129
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 1.08e-53
Family Globins 0.000000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3N129
Sequence length 147
Comment (tr|I3N129|I3N129_ICTTR) Uncharacterized protein {ECO:0000313|Ensembl:ENSSTOP00000018075} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=LOC101967554 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MVHFTAEDKAAITSMWRKVNVEEAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPK
VKAHGKKVLTSLGNALRDMDDLKGAFSQLSELHCERLHVDPENFRLLGNMLVIIMAKHFG
KEFTPEMQASWQKMVAGVASALAHKYH
Download sequence
Identical sequences I3N129
ENSSTOP00000018075 ENSSTOP00000018075 XP_005342579.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]