SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3N2W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3N2W9
Domain Number 1 Region: 182-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.3e-58
Family Voltage-gated potassium channels 0.0008
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.68e-32
Family Tetramerization domain of potassium channels 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3N2W9
Sequence length 649
Comment (tr|I3N2W9|I3N2W9_ICTTR) Potassium voltage-gated channel subfamily D member 1 {ECO:0000313|Ensembl:ENSSTOP00000018715} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=KCND1 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MAAGVATWLPFARAAAVGWLPLAQQPLPPAPGVKASRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGDGPALPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGPARRPPREQPCGDRFPTAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLFVPKNDDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTSKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEGQALCIRNRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSLGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRR
AIRLANSTASVSRGSMQELDTLAGLRRSPAPQSRSSLNAKPHDSLDLNCDSRDFVAAIIS
IPTPPANTPDESQPSSPGGGGGGRASSTLRNSSVDTPCLLPETVKISSL
Download sequence
Identical sequences I3N2W9
ENSSTOP00000018715 ENSSTOP00000018715 XP_005338724.1.77405 XP_021591197.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]