SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3N6D0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3N6D0
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 2.17e-55
Family C-type lysozyme 0.000000584
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3N6D0
Sequence length 148
Comment (tr|I3N6D0|I3N6D0_ICTTR) Lysozyme {ECO:0000256|SAAS:SAAS00814457} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=LYZ OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MKAFLILGLLLLSVTVQGKVYGRCELARALKRLGMDGYRGISLANWVCLAKWESSYNTRA
TNYNPGSRSTDYGIFQINSRYWCNDGKTPRAVNACGISCSALLQDDISQAVTCAKRVVRD
PQGIRAWVAWRNRCQNRNLSQYIQGCGV
Download sequence
Identical sequences I3N6D0
ENSSTOP00000019926 ENSSTOP00000019926 XP_005328788.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]