SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3NAQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3NAQ2
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000112
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000275
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3NAQ2
Sequence length 268
Comment (tr|I3NAQ2|I3NAQ2_ICTTR) Somatomedin B and thrombospondin type 1 domain containing {ECO:0000313|Ensembl:ENSSTOP00000021449} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=SBSPON OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MRTLWMALCALAHLWPGALAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACRLTG
DCCFDYARACPARPCFVGEWSPWSGCADQCKPTIRVRRRSVRQEPQNGGAPCPPLEERAG
CLEYATRQGDDGMVAALVTSFPAFITTSAFNKERTRQAASPQWSTHTEDAGYCMEFKTES
LTPHCALENRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIG
NPRCQGTWKKVRRVDHCSCPAVHSFIFI
Download sequence
Identical sequences I3NAQ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]