SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3NAX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3NAX1
Domain Number 1 Region: 24-74
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000017
Family Elafin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3NAX1
Sequence length 78
Comment (tr|I3NAX1|I3NAX1_ICTTR) Uncharacterized protein {ECO:0000313|Ensembl:ENSSTOP00000021518} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN= OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MKLSSLSLLSVAALLWLRVAQANMKEVQQKSGYCPEFFLSCSFTLLPRCRRDGGCNGPKK
CCFYQCQQQCMQPWPTLD
Download sequence
Identical sequences I3NAX1
XP_021582132.1.77405 XP_021582133.1.77405 ENSSTOP00000021518 ENSSTOP00000021518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]