SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3NE01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3NE01
Domain Number 1 Region: 20-144
Classification Level Classification E-value
Superfamily Lysozyme-like 1.77e-37
Family C-type lysozyme 0.0000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3NE01
Sequence length 145
Comment (tr|I3NE01|I3NE01_ICTTR) Lysozyme like 4 {ECO:0000313|Ensembl:ENSSTOP00000022598} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=LYZL4 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MKASVMLFLLGYLMVPSGARVLGRCTVADMLYRGGLDYFEGYKLENWVCLAYYESKFNPS
AVYENEITGHTGFGLFQIREDLWCDHGKNLCSVSCSELLNPDLKKTIECVKKIVKGKQGM
GAWLNWTRNCQFSDTLSRWLDGCRL
Download sequence
Identical sequences I3NE01
ENSSTOP00000022598 XP_005337996.1.77405 ENSSTOP00000022598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]