SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3R748 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3R748
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 4.19e-55
Family NADH oxidase/flavin reductase 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3R748
Sequence length 223
Comment (tr|I3R748|I3R748_HALMT) Putative NAD(P)H nitroreductase {ECO:0000313|EMBL:AFK20058.1} KW=Complete proteome; Reference proteome OX=523841 OS=14739 / NCIMB 2177 / R-4) (Halobacterium mediterranei). GN=BM92_12650 OC=Haloferax.
Sequence
MDFEEVVATRRSIHEYADEPLDDETLETIFENAIQAPSSYNLQPWEFVVLREDETKQALR
EAAYDQEHVTGAAASVIILGNKDPEAHAQTVADDMLEKGYLPNEDARDGVLESIAGMADL
PEQERRVWTVRSTSLVAMSLMNAAWDEGVGTCPIGGFDPDAVLEAFDIDGEQYEPVMLLT
MGIPAEDAGELQAEKKYRRPVDEVVHYEAFAPEQTADPAPADD
Download sequence
Identical sequences I3R748
gi|389847806|ref|YP_006350045.1| WP_004059783.1.26851 WP_004059783.1.35700 WP_004059783.1.77170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]