SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3SCK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I3SCK6
Domain Number - Region: 143-193
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0266
Family Carboxylesterase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3SCK6
Sequence length 269
Comment (tr|I3SCK6|I3SCK6_LOTJA) Pectin acetylesterase {ECO:0000256|RuleBase:RU363114} OX=34305 OS=Lotus japonicus (Lotus corniculatus var. japonicus). GN= OC=Loteae; Lotus.
Sequence
MECPRMGQWLSLLLCLLLLLKAEGVAVPITFVQSAVAKGAVCLDGSPPAYHFHKGFGAGI
NNWIVHFEGGAWCNNVTTCLARRDTRLGSSKKMSQTLSFSGFFSNGQKFNPDFYNWNRIK
VRYCDGSSFTGDVEAVDPKTNLHFRGGRIFVAVVEDLLANGMKNAQNAILSGCSAGGLTS
ILQCDRFRSLIPAAAKVKCLSDAGYFINLKDVSGAAHIEQLYSQVVETHGSAKNLPASCT
SRLRPGLCFFSPKCGRANQNTNLLCQCSV
Download sequence
Identical sequences I3SCK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]