SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3TEG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I3TEG1
Domain Number - Region: 11-106
Classification Level Classification E-value
Superfamily Prefoldin 0.0288
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3TEG1
Sequence length 136
Comment (tr|I3TEG1|I3TEG1_THEC1) Uncharacterized protein {ECO:0000313|EMBL:AFK51149.1} KW=Complete proteome; Reference proteome OX=1184251 OS=Thermogladius calderae (strain DSM 22663 / VKM B-2946 / 1633). GN=TCELL_0725 OC=Desulfurococcaceae; Thermogladius.
Sequence
MIVREFKSVGELIKFIDEQINSYRALLAEFLRRLEDVRVRSEQEKKLKDLLKNLGVAETK
KSTVIDLKDSKLIIDPSAEEESKVIEETVERLNKNIQVLQSIRKTLDPLANLDIEAKITV
VLRDGIPASVLIKLGS
Download sequence
Identical sequences I3TEG1
gi|389861047|ref|YP_006363287.1| WP_014737399.1.39459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]