SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3TEL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3TEL9
Domain Number 1 Region: 4-153
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.25e-25
Family GHMP Kinase, N-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 168-279
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.12e-21
Family Homoserine kinase 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3TEL9
Sequence length 314
Comment (tr|I3TEL9|I3TEL9_THEC1) Homoserine kinase {ECO:0000256|HAMAP-Rule:MF_00384} KW=Complete proteome; Reference proteome OX=1184251 OS=Thermogladius calderae (strain DSM 22663 / VKM B-2946 / 1633). GN=TCELL_0783 OC=Desulfurococcaceae; Thermogladius.
Sequence
MCDREAVVKSPGSIANLGPGFDVLAVALSGLHDLVHVKASPGTGLVRVYSDVPVLTGSSN
NAHAVAVKSLEKFKWLSSCDIEIYVRKGVPVSVGLGSSGATAAGAAFALSLIAGSVDEET
VLSLAGEGERFVSGVAHYDNVAASLLGGVVIVDTKYKKAYKIEIPKEIHVGVVIPETGAR
TEKKTYVARSILPGKIDLETHVQQSSSLAKLVYGLIKGDLRLVGRAISEDEICEPSRSKL
IPLYREMKDIALREGAYGFNIAGAGPSVFYIHDDLDEITRIGGVILDFLKSKGVKASLLA
SRFSNQGVEVVSGG
Download sequence
Identical sequences I3TEL9
gi|389861105|ref|YP_006363345.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]