SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3TEX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3TEX8
Domain Number 1 Region: 165-514
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 1.15e-113
Family Nqo4-like 0.00000452
Further Details:      
 
Domain Number 2 Region: 11-170
Classification Level Classification E-value
Superfamily Nqo5-like 6.15e-27
Family Nqo5-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3TEX8
Sequence length 538
Comment (tr|I3TEX8|I3TEX8_THEC1) Membrane-bound hydrogenase, subunit NuoCD {ECO:0000313|EMBL:AFK51316.1} KW=Complete proteome; Reference proteome OX=1184251 OS=Thermogladius calderae (strain DSM 22663 / VKM B-2946 / 1633). GN=TCELL_0892 OC=Desulfurococcaceae; Thermogladius.
Sequence
MGGKLIQEKTKVSRDALLDSIRLFMEQGFSNIVAITGVDRKDNIELIYHLGDEHGGMVHL
SVQLPKGDPVVDDISSLKPGAKILEREVHDLFGVEFWGFDELDKKRLLLPECYPEKASPP
LLKDVDSDTFKKYIGDPMACAYEALTLSAPLSPESALVPIGPYHPALKEPEFFSLVVEGE
RIKKAFVRIGFVHRGIEKLAESRTYIKDIFLFERVCGICSTHHAWTFVEAVEKLLNVDPP
PRAQYLRTLIAELERIHSHSLWLGLIGYWIGFESMFMWVWGLRETVMDLFEELTGNRVHK
SFITIGGVRMDISDEKVKKAAAKVSEFEKQIDSVMETVMSSDLFIERSKGIAKYTLEEAR
AFSAVGPVRRAAGDPYDIRRIEPYGAYGELDFEVRTTKTGDVYNLVLLRLGEIKESARII
RQIAEKIPSGNPVPPKPFLGVVKEGEAYARTEAPRGELFYYVNSNNTAYPYRVKVRTPTL
LNIQLAAHLLEGATLSDFPVIVTSIDPCFSCMDRVLVYDERAGCAKIISAEEIGRKRM
Download sequence
Identical sequences I3TEX8
WP_014737566.1.39459 gi|389861214|ref|YP_006363454.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]