SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3TFD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3TFD6
Domain Number 1 Region: 96-266
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 5.89e-32
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.085
Further Details:      
 
Domain Number 2 Region: 11-101
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.00000000000181
Family Ferredoxin reductase FAD-binding domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3TFD6
Sequence length 275
Comment (tr|I3TFD6|I3TFD6_THEC1) [NiFe] hydrogenase, gamma subunit {ECO:0000313|EMBL:AFK51474.1} KW=Complete proteome; Reference proteome OX=1184251 OS=Thermogladius calderae (strain DSM 22663 / VKM B-2946 / 1633). GN=TCELL_1051 OC=Desulfurococcaceae; Thermogladius.
Sequence
MRSPFAELRKGLVIGEVYEAPGVKTLAVRLVDEVPPPRPGQFNMVYVHGLGEVPLSVSGI
REGGRVVEHTVRAAGAVTRALVYREWRGCLVGLRGPYGRGWPLEEAEGHDLLVVAGGMGF
APLRPVLKWVAERRERYGRVNVLVGARTPRDLLFKYELESYRGLPGTRLLLSVDRPEGAW
EGHVGLVTDLIRLADVDPGGSYAFVCGPEPMMVNTVKALKERGFREDRVFLSLERRMRCG
TGFCGTCQLGHYFTCRDGPVFRLTEVSDYLAVEGV
Download sequence
Identical sequences I3TFD6
WP_014737724.1.39459 gi|389861372|ref|YP_006363612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]