SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3U7J3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3U7J3
Domain Number 1 Region: 21-182
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.89e-23
Family AD-003 protein-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3U7J3
Sequence length 200
Comment (tr|I3U7J3|I3U7J3_ADVKW) SAM-dependent methyltransferase {ECO:0000313|EMBL:AFK60981.1} KW=Complete proteome; Reference proteome OX=1036672 OS=(Tetrathiobacter kashmirensis). GN=TKWG_01595 OC=Alcaligenaceae.
Sequence
MVEIAGSKGYAEKAQRFAADYESVTFEKVHNPVRGFYPGAPAKVLDIGAGTGRDAAALAA
LGYQVDAVEPTAAMREQGDLHHADANINWIADSLPELALVRASAKRYDLILLTAVWMHLR
EEERLPAMQHCAALLGRNGIMSMSLRHGPVPAERHMFDIPDEETIALAHTCGLQLLYQKS
YKNDTLGRNDISWSYAVFRK
Download sequence
Identical sequences I3U7J3
gi|389870544|ref|YP_006377963.1| WP_014749072.1.62074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]