SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3U7S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3U7S6
Domain Number 1 Region: 38-171
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000301
Family BC2162-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3U7S6
Sequence length 273
Comment (tr|I3U7S6|I3U7S6_ADVKW) Uncharacterized protein {ECO:0000313|EMBL:AFK61064.1} KW=Complete proteome; Reference proteome OX=1036672 OS=(Tetrathiobacter kashmirensis). GN=TKWG_02080 OC=Alcaligenaceae.
Sequence
MTLIPEIKPQQSLELLKELHILTREGKINQDTRRKLKQVYHLYQFIEPLMQTVLDQGQGL
SLVDHGAGKSYLGFILYDLFLKEHVSATVYGIESRAELVRKSEDLARRLGFDGMQFKDMT
VEQSIASAELPEKIDIVTALHACNTATDDAIRFALARDARFIVLVPCCQAEVAAALRATK
GNTLGKTPLSELWRHPLHTREFGSQITNVLRCLQLEARGYQVTVTELVGWEHSMKNELII
AKKTGGFKKSARERQLAILKECHLEALQERFAY
Download sequence
Identical sequences I3U7S6
gi|389870627|ref|YP_006378046.1| WP_014749155.1.62074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]