SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3U8D8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3U8D8
Domain Number 1 Region: 39-405
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.04e-84
Family RPA4359-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3U8D8
Sequence length 414
Comment (tr|I3U8D8|I3U8D8_ADVKW) Uncharacterized protein {ECO:0000313|EMBL:AFK61276.1} KW=Complete proteome; Reference proteome OX=1036672 OS=(Tetrathiobacter kashmirensis). GN=TKWG_03425 OC=Alcaligenaceae.
Sequence
MRADPTGAALPQIQEAAQRYSENARHKLAGLIHEAGPQGLPFARWMHAALYDPQAGYYAG
APLKFGDTAAAAGTALQGDFVTAPELTPWFGRSLARQIGPILAHIGTPHILEFGAGSGAL
AEHILQALLPEFPELQYYILDISPDLTQRQQQRLAPFGDSVHWLHSLPSGFSGCIIANEV
LDAMPVSLFEWGEDGNVHELHVINKPGEASAAADPQADQEAQASSYFDFLRVPAGALLEQ
AVRTRMPALPGYRSEINLQGESWVAGLGQWLDQGVALLIDYGFPQHEYYHPQRSQGTLMC
HLLHHAHSQVLHFPGIQDITAHVDFTAMADAALAADLEVLGYTSQARFLLNCGLLQMLSE
LDPDDTARYAREIGPVQKLLSEAEMGELFKVLAIGKNVDMDLMAFATGDRRHRL
Download sequence
Identical sequences I3U8D8
WP_014749367.1.62074 gi|389870839|ref|YP_006378258.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]