SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3UBM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3UBM2
Domain Number 1 Region: 110-363
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.89e-75
Family Mycolic acid cyclopropane synthase 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3UBM2
Sequence length 377
Comment (tr|I3UBM2|I3UBM2_ADVKW) Cyclopropane fatty acyl phospholipid synthase {ECO:0000313|EMBL:AFK62410.1} KW=Complete proteome; Reference proteome OX=1036672 OS=(Tetrathiobacter kashmirensis). GN=TKWG_10830 OC=Alcaligenaceae.
Sequence
MAVGSQHSASLDHLSKIAAMAGVTINGDAPWDLRLTDNKAADRILAQGSMGLGESYMDGQ
WECDQIDEMITRLLRHRIDDKVRSAATLWHILRARFVNNQTRSKAWEVGEKHYDLGNEFF
RDMLDARMTYTCGYWDNASTLDEAQEAKLDLVCQKMGLKPGMTVLDIGCGWGSFMRFAAE
RYGAHCTGITISKEQAEYGQKMCEGLPVQFLLQDYRDLTGQYDRIVSLGMFEHVGRKNYR
TYFEAARRNLKEDGLFLMHTIGGRVRDHDPDPWIHKYIFPNGEIPVIGQVADHTQGLFLI
EDLHNFGADYDKTLMAWHANFEKHWHKHASQYSERFYRMWRYYLLICAGSFRARDNQLWQ
FVLSPNGVPGGYRRPKL
Download sequence
Identical sequences I3UBM2
WP_014750501.1.62074 gi|389871973|ref|YP_006379392.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]