SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3UD45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3UD45
Domain Number 1 Region: 12-265
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.22e-53
Family N5-glutamine methyltransferase, HemK 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3UD45
Sequence length 299
Comment (tr|I3UD45|I3UD45_ADVKW) N5-glutamine methyltransferase PrmB {ECO:0000256|HAMAP-Rule:MF_02125} KW=Complete proteome; Reference proteome OX=1036672 OS=(Tetrathiobacter kashmirensis). GN=TKWG_14275 OC=Alcaligenaceae.
Sequence
MASKIHNELKTVRDVIRYAVSRFNDAQLAFGHGSDNAWDEAVYLVLSTLHLPLDTLDPFL
DARLLEDEKKKCVSLIELRVKKRVPLAYLTGEAWLQGHRFLTDKRVIVPRSPISELLAEH
LEPWVDDPENVQNVLDLCTGSGCLAILAALAFPNAQVDAVDLSDHAIRLAQRNVDMYQLG
ERVNVLQGDLYAPLEKQRYDVIVCNPPYVNSTTMAQLPSEYQHEPALALAGGDDGMDIIR
TILDQAAAHLSDDGFIILEIGNEYENFMNAFPALNPVFLETAEGDDSVLLLTREQLQPR
Download sequence
Identical sequences I3UD45
WP_014751024.1.62074 gi|389872496|ref|YP_006379915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]