SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3UEQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3UEQ1
Domain Number 1 Region: 54-168
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.94e-26
Family Hypothetical Protein YjhP 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3UEQ1
Sequence length 282
Comment (tr|I3UEQ1|I3UEQ1_ADVKW) RNA methylase {ECO:0000313|EMBL:AFK63489.1} KW=Complete proteome; Reference proteome OX=1036672 OS=(Tetrathiobacter kashmirensis). GN=TKWG_18065 OC=Alcaligenaceae.
Sequence
MTTPAKPLVAAILFTMTVSSPLAAQTAPAAADNNATTKQYTPSVGQQGKDVVWVPTSQAL
VDRMLQMARLTADDRLVDLGSGDGRLVITAAKRGAISRGIEFNPDLVAISKRAAQTEGVA
QRATFEQADIFESDFSDATVVTLFLLPSLNLRLRPTLLDMKPGTRVVSNSFAMEAWEPDE
SVEVKENCTNYCHAYKWIVPAKVAGTWKIGERELQLKQTFQMLDGTLSDGANQRRISNAR
LNGAHITFSVDGQTYSGKVENKQMRGTIDGKADWTARLVSMQ
Download sequence
Identical sequences I3UEQ1
WP_014751580.1.62074 gi|389873052|ref|YP_006380471.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]