SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3UFM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3UFM9
Domain Number 1 Region: 17-193
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.79e-39
Family YhhF-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3UFM9
Sequence length 202
Comment (tr|I3UFM9|I3UFM9_ADVKW) Uncharacterized protein {ECO:0000313|EMBL:AFK63817.1} KW=Complete proteome; Reference proteome OX=1036672 OS=(Tetrathiobacter kashmirensis). GN=TKWG_20260 OC=Alcaligenaceae.
Sequence
MKPANRPAGTSGKRQTIRIIGGQYRRSQIPVVDADGLRPTSDRIRETLFNWLNYLWDGRF
DDKSVLDLFAGTGALGFEAASRGAAHVQMAETSPAALATLRATRDKLQASQVRINSADAF
LMLKRMDASRFDLVMLDPPFAGKLFDRIFPFLPAIVKPGGLVYIESDQPEDPGSDFPAIR
QGKAGQVYYQLHEHLIAPHKSE
Download sequence
Identical sequences I3UFM9
gi|389873380|ref|YP_006380799.1| WP_014751908.1.62074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]