SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3UGX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3UGX9
Domain Number 1 Region: 6-154
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.36e-35
Family FkbM-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3UGX9
Sequence length 394
Comment (tr|I3UGX9|I3UGX9_ADVKW) FkbM family methyltransferase {ECO:0000313|EMBL:AFK64267.1} KW=Complete proteome; Reference proteome OX=1036672 OS=(Tetrathiobacter kashmirensis). GN=TKWG_23350 OC=Alcaligenaceae.
Sequence
MHSSGCGANIGNHTFYLAQVMGCQVIAFEANDELAHAMDITASEAGLEEKVTVYAFALGA
KPGFAEFDHAIPENLGGQSLRTGTGRIKVRTLDSFGISAPVSAIKIDVEGMELEVLKGGK
KVIESNLPMLYVESQTKESFIEISSYLNTLGYCYRNTFNATPTHLFIHKTKLNDDDHMAL
SALNRVEHEYDLLAANQRIKKDLVDCQMKYREICQLSSSLKSENERLQEQLQVNTAAADQ
TDIIRLQTELDQAKRKEASADQLIERLRDEIARERSEKEFQAQQLSQRSHAGSADIELRE
RLTAEVERLGAENRSQKALLDGQQALKSALEDSKKKREEMSFILENTQSEVAQLQAEKGK
LLAVIKEKDEDAAELSTEKTAAVADRERQTACCD
Download sequence
Identical sequences I3UGX9
gi|389873830|ref|YP_006381249.1| WP_014752358.1.62074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]