SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3WAD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3WAD0
Domain Number 1 Region: 387-665
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.59e-54
Family Eukaryotic proteases 0.00082
Further Details:      
 
Domain Number 2 Region: 79-118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 170-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 4 Region: 263-325
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000208
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 5 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 6 Region: 116-155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 7 Region: 203-245
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3WAD0
Sequence length 670
Comment (tr|I3WAD0|I3WAD0_BOMMO) Hemolymph protein 14 {ECO:0000313|EMBL:AFK93534.1} OX=7091 OS=Bombyx mori (Silk moth). GN=HP14 OC=Bombycoidea; Bombycidae; Bombycinae; Bombyx.
Sequence
MYLYLSVILFVTSSVLTKITNPYDSSCSYNEFECGDGGCVSIDRVCNGIEDCSGAEDETV
CYEIPAKFGLHSSRRRRQTSNCKKSEWRCRDGTCISFDGKCDGVVDCPDSSDETHALCGK
TTCQSNWFRCTYGACVDGTAPCNGIQECADNSDELLPQCRGNEVADATNLRDKFKCADGN
VIPATAFCDGVADCPDGSDETVQACAGRTCPAYLFQCAYGACVDAGSDCNGIKECADGSD
ESDELCDRVLSGKPTQKPSASGGCVLPQYPAHGSYVVLNTPNATPGQTFDSIQVNVTCKP
GYGVMGRNDVFCLNGWWSDKLPQCVRFCTLNSHASVEYKCLLTNGNEGTRPCGSLEPTGT
IVQPQCRSPNYYSTVPLGYMRCIEGNWDYVATCTPECGRVTPDGEELVFGGRSAKRGELP
WHAGIYRKTSTPYMQICGGSLVSTTVVISAAHCFWSNLNQQLPTTDYAVAVGKIYRPWNN
PKDLDVQKSDVRDIKIPIRFQGRTANFQEDIAIVILATRIEYRTYVRPACLDFDISFERQ
QLQDGKPGKVAGWGLTSENGNASQILKVVDLPYIDIDRCIGMAPPGFREYINGDKICAGD
GEGKALCKGDSGGGLAFSTYDKGVERYYLRGIVSTASTNENLCNTNTFTTFTQVSKHEHF
IKQYLHVVQT
Download sequence
Identical sequences I3WAD0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]