SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3XQ12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I3XQ12
Domain Number - Region: 455-537
Classification Level Classification E-value
Superfamily Prefoldin 0.0288
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3XQ12
Sequence length 664
Comment (tr|I3XQ12|I3XQ12_DESAM) Uncharacterized protein {ECO:0000313|EMBL:AFL66036.1} KW=Complete proteome OX=768672 OS=Desulfurococcus amylolyticus DSM 16532. GN=Desfe_0123 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MNLISDLSPVGSGINRCFKLSNYLGDTIVVTVIGVDIQPGSSPNSRRQPLYSAVVLRDGE
IIASFEDVELYRLLRLVLEYHVDIIAVDNVYELASSENELRRIFELLPGNVKVVQVTGPP
NDARDVNSVARELGIDKVIETPLKTAYINALAAYRGIGYEVRLFAEKTRIVVTKGRSVTQ
GGMSRDRFLRCIRAGIAQATKEIKRILDENKLDYDMVIKRSKGGLEKSVFIVYAPRESLY
GLIKPLKYKNVKIIIKPYASRKPIEPVSDQARKPVIVGVDPGMSIGVSVLTLDGEPVLIT
SMKSPDRDEIINLISRIGKPVVVATDVSKPPETVVKLASMLNAVLYVPEQDITIDEKNRI
AREYSEKYMVNIPDSHTRDALAAAVKAYNNYKATIEEVKSKLANVKKVDRYQLIAEIIKG
KPFSEVLEEYFKRSIPKNPPLVEEKMKPTTTPVCEKLNEKVNTLEALVRKLLDEIERKDL
YIKDLELELKLTRSRKPGIEDYERKISVLQNELEALRRKIEDKDNVIRELYEKLLQLEEH
VVKLGRGDLVMIPKVSTVRREGGLVNRGVYMEKVLDVSSELKNILTSGRGFIVSPVVAVD
PLKERIPVVKPEIIYDLGDYVIVEKEVIEKANELWRKIDELIELERHERILRMIEEYQRS
RKNS
Download sequence
Identical sequences I3XQ12
gi|390937873|ref|YP_006401611.1| WP_014766941.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]